Novus Biologicals
Manufacturer Code:NBP276483
Catalog # NBP276483
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Mouse |
Class | Monoclonal |
Type | Antibody |
Clone | CL7318 |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Mouse Monoclonal Antibody
Protein Aliases: alpha 2 subunit of VLA-2 receptor; alpha-2 subunit CD49b antigen integrin alpha 2 (CD49B alpha 2 subunit of VLA-2 receptor) VLA 2; CD49 antigen-like family member B; CD49b; Collagen receptor; GPIa; human platelet alloantigen system 5; Integrin alpha-2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); platelet antigen Br; platelet glycoprotein GPIa; Platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; VLA-2 subunit alpha
Gene Aliases: BR; CD49B; GPIa; HPA-5; ITGA2; VLA-2; VLAA2
UniProt ID: (Human) P17301
Entrez Gene ID: (Human) 3673
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.