Novus Biologicals
Manufacturer Code:NBP17414020UL
Catalog # NBP17414020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the middle region of Insr. Immunizing peptide sequence EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD 220 CD220 CD220 antigen EC 2.7.10 EC 2.7.10.1 HHF5 insulin receptor IR; CD220; Insulin receptor; Insulin receptor subunit alpha; Insulin receptor subunit beta; IR
Gene Aliases: CD220; HHF5; INSR
UniProt ID: (Human) P06213
Entrez Gene ID: (Human) 3643
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.