Novus Biologicals
Manufacturer Code:NBP15947220UL
Catalog # NBP15947220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the middle region of IMPAD1. Peptide sequence TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTII. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3'(2'), 5'-bisphosphate nucleotidase 2; EC 3.1.3 EC 3.1.3.25 FLJ20421 IMP 3 IMPA3IMPase 3 inositol monophosphatase 3 inositol monophosphatase domain containing 1 Inositol monophosphatase domain-containing protein 1 Inositol-1(or 4)-monophosphatase 3 Myo-inositol monophosphatase A3; Golgi 3-prime phosphoadenosine 5-prime phosphate 3-prime phosphatase; Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase; golgi-resident nucleotide phosphatase; Golgi-resident PAP phosphatase; IMPase 3; Inositol monophosphatase domain-containing protein 1; inositol-1(or 4)-monophosphatase 3; Myo-inositol monophosphatase A3; Phosphoadenosine phosphate 3'-nucleotidase
Gene Aliases: BPNT2; GPAPP; IMP 3; IMP-3; IMPA3; IMPAD1
UniProt ID: (Human) Q9NX62
Entrez Gene ID: (Human) 54928
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.