Novus Biologicals
Manufacturer Code:NBP247418
Catalog # NBP247418
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEMAPGGVITSDMIEMIFSKSPEQQLSATQK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: importin alpha 5; importin subunit alpha-1; importin subunit alpha-1 importin-alpha-S1 IPOA5 karyopherin alpha 1 (importin alpha 5) Karyopherin subunit alpha-1 NPI-1SRP1importin alpha 5 Nucleoprotein interactor 1 RCH2RAG cohort protein 2 recombination activating gene cohort 2 SRP1-beta; Importin subunit alpha-5; Importin subunit alpha-5, N-terminally processed; importin-alpha-S1; karyopherin alpha 1 (importin alpha 5); Karyopherin subunit alpha-1; NPI-1; Nucleoprotein interactor 1; RAG cohort protein 2; recombination activating gene cohort 2; SRP1-beta
Gene Aliases: IPOA5; KPNA1; NPI-1; RCH2; SRP1
UniProt ID: (Human) P52294
Entrez Gene ID: (Human) 3836
Molecular Function:
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.