Novus Biologicals
Manufacturer Code:NBP238541
Catalog # NBP238541
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: importin alpha 3 Importin alpha Q1 importin subunit alpha-4 importin-alpha-Q1 IPOA3 karyopherin alpha 4 (importin alpha 3) MGC12217 MGC26703 Qip1 QIP1Karyopherin subunit alpha-4 SRP3; Importin alpha Q1; Importin subunit alpha-3; importin subunit alpha-4; karyopherin alpha 4 (importin alpha 3); Karyopherin subunit alpha-4; Qip1
Gene Aliases: IPOA3; KPNA4; QIP1; SRP3
UniProt ID: (Human) O00629
Entrez Gene ID: (Human) 3840
Molecular Function: transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.