Novus Biologicals
Manufacturer Code:NBP238482
Catalog # NBP238482
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: importin alpha 1 importin-alpha-P1 IPOA1 karyopherin alpha 2 (RAG cohort 1 importin alpha 1) Karyopherin subunit alpha-2 pendulin QIP2importin alpha 2 RAG cohort 1 RAG cohort protein 1 RCH1importin subunit alpha-2 SRP1 SRP1alpha SRP1-alpha; Importin subunit alpha-1; importin subunit alpha-2; importin-alpha-P1; karyopherin alpha 2 (RAG cohort 1, importin alpha 1); Karyopherin subunit alpha-2; pendulin; RAG cohort protein 1; SRP1-alpha
Gene Aliases: IPOA1; KPNA2; QIP2; RCH1; SRP1; SRP1-alpha; SRP1alpha
UniProt ID: (Human) P52292
Entrez Gene ID: (Human) 3838
Molecular Function:
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.