Novus Biologicals
Manufacturer Code:NBP189180
Catalog # NBP189180
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AIF4 AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)) atrophin-1 interacting protein 4 Atrophin-1-interacting protein 4 dJ468O1.1 EC 6.3.2 EC 6.3.2.- Itch itchy (mouse homolog) E3 ubiquitin protein ligase itchy E3 ubiquitin protein ligase homolog (mouse) itchy homolog E3 ubiquitin protein ligase NAPP1E3 ubiquitin-protein ligase Itchy homolog NFE2-associated polypeptide 1 ubiquitin protein ligase ITCH; AIP4; atrophin-1 interacting protein 4; Atrophin-1-interacting protein 4; E3 ubiquitin-protein ligase Itchy homolog; HECT-type E3 ubiquitin transferase Itchy homolog; Itch; itchy E3 ubiquitin protein ligase homolog; NAPP1; NFE2-associated polypeptide 1
Gene Aliases: ADMFD; AIF4; AIP4; ITCH; NAPP1
UniProt ID: (Human) Q96J02
Entrez Gene ID: (Human) 83737
Molecular Function:
ligase
ubiquitin-protein ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.