Novus Biologicals
Manufacturer Code:NBP15498420UL
Catalog # NBP15498420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ISYNA1(myo-inositol 1-phosphate synthase A1) The peptide sequence was selected from the N terminal of ISYNA1. Peptide sequence LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 5.5.1.4 hINO1 hIPS INO1 INOS inositol-3-phosphate synthase 1 IPSIPS 1 MI-1-P synthase MIP synthase Myo-inositol 1-phosphate synthase A1 Myo-inositol-1-phosphate synthase; hINO1; Inositol-3-phosphate synthase 1; IPS 1; MI-1-P synthase; MIP synthase; Myo-inositol 1-phosphate synthase; Myo-inositol 1-phosphate synthase A1; testis secretory sperm-binding protein Li 200a
Gene Aliases: INO1; INOS; IPS; IPS 1; IPS-1; ISYNA1
UniProt ID: (Human) Q9NPH2
Entrez Gene ID: (Human) 51477
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.