Novus Biologicals
Manufacturer Code:NBP157213
Catalog # NBP157213
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ISG20(interferon stimulated exonuclease gene 20kDa) The peptide sequence was selected from the middle region of ISG20. Peptide sequence TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD25 Estrogen-regulated transcript 45 protein HEM45EC 3.1.13.1 interferon stimulated exonuclease gene 20kDa interferon stimulated gene (20kD) interferon-stimulated gene 20 kDa protein Promyelocytic leukemia nuclear body-associated protein ISG20; Estrogen-regulated transcript 45 protein; interferon stimulated exonuclease gene 20kDa; Interferon-stimulated gene 20 kDa protein; Promyelocytic leukemia nuclear body-associated protein ISG20
Gene Aliases: CD25; HEM45; ISG20
UniProt ID: (Human) Q96AZ6
Entrez Gene ID: (Human) 3669
Molecular Function: RNA binding protein exoribonuclease nuclease nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.