Novus Biologicals
Manufacturer Code:NBP255039
Catalog # NBP255039
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTVDHSLQIDFSKCAIQNAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTCRGSCDSGELGRNSGTFSSQIENTPILCPFHLQPVPEPETVLK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACO3 EC 4.2.1.3 FLJ23381 IRE-BP 2 Iron regulatory protein 2 iron-responsive element binding protein 2 iron-responsive element-binding protein 2 IRP2IRP2AD; IRE-BP 2; Iron regulatory protein 2; iron-responsive element binding protein 2; Iron-responsive element-binding protein 2; IRP2
Gene Aliases: ACO3; IREB2; IRP2; IRP2AD
UniProt ID: (Human) P48200
Entrez Gene ID: (Human) 3658
Molecular Function:
dehydratase
hydratase
lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.