Novus Biologicals
Manufacturer Code:NBP233689
Catalog # NBP233689
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QRFYESLPLAMKRFTPQYKGTVTVHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP:1D-myo-inositol-hexakisphosphate phosphotransferase; IHPK3ATP:1D-myo-inositol-hexakisphosphate phosphotransferase inositol hexakisphosphate kinase 3 Inositol hexaphosphate kinase 3EC 2.7.4.21 InsP6 kinase 3 INSP6K3MGC102928; Inositol hexakisphosphate kinase 3; Inositol hexaphosphate kinase 3; InsP6 kinase 3
Gene Aliases: IHPK3; INSP6K3; IP6K3
UniProt ID: (Human) Q96PC2
Entrez Gene ID: (Human) 117283
Molecular Function: kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.