Novus Biologicals
Manufacturer Code:NBP198398
Catalog # NBP198398
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Ip6k1 - N-terminal region. Peptide sequence YPYVESETVEQDDTPEREQPRRKHSRRSLHRSGSGSDHKEEKASLSFETS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP:1D-myo-inositol-hexakisphosphate phosphotransferase; ATP:1D-myo-inositol-hexakisphosphate phosphotransferase EC 2.7.4.21 inositol hexakisphosphate kinase 1 Inositol hexaphosphate kinase 1KIAA0263IHPK1PiUS InsP6 kinase 1 MGC9925 Pi uptake stimulator; Inositol hexakisphosphate kinase 1; Inositol hexaphosphate kinase 1; InsP6 kinase 1; Pi uptake stimulator
Gene Aliases: IHPK1; IP6K1; KIAA0263; PiUS
UniProt ID: (Human) Q92551
Entrez Gene ID: (Human) 9807
Molecular Function: kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.