Novus Biologicals
Manufacturer Code:NBP155379
Catalog # NBP155379
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to INSL5(insulin-like 5) The peptide sequence was selected from the middle region of INSL5. Peptide sequence RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: insulin-like 5; insulin-like 5 Insulin-like peptide 5 insulin-like peptide INSL5 MGC126695 MGC126697 PRO182 UNQ156; Insulin-like peptide 5; Insulin-like peptide INSL5; Insulin-like peptide INSL5 A chain; Insulin-like peptide INSL5 B chain; prepro-INSL5
Gene Aliases: INSL5; PRO182; UNQ156; UNQ156/PRO182
UniProt ID: (Human) Q9Y5Q6
Entrez Gene ID: (Human) 10022
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.