Novus Biologicals
Manufacturer Code:NBP159729
Catalog # NBP159729
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to INSIG-1(insulin induced gene 1) The peptide sequence was selected from the middle region of INSIG-1 (NP_938150). Peptide sequence ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: CL6 CL-6 INSIG-1 INSIG-1 membrane protein insulin induced gene 1 insulin-induced gene 1 protein MGC1405; INSIG-1; INSIG-1 membrane protein; Insulin-induced gene 1 protein
Gene Aliases: CL-6; CL6; INSIG1
UniProt ID: (Human) O15503
Entrez Gene ID: (Human) 3638
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.