Novus Biologicals
Manufacturer Code:NBP186352
Catalog # NBP186352
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.3.25 IMP 2 IMP.18P IMPase 2 inosine monophosphatase 2 inositol monophosphatase 2 inositol monophosphatase 2 variant 1 inositol monophosphatase 2 variant 2 inositol(myo)-1(or 4)-monophosphatase 2 Inositol-1(or 4)-monophosphatase 2 Myo-inositol monophosphatase A2; IMP 2; IMPase 2; inosine monophosphatase 2; Inositol monophosphatase 2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2; inositol(myo)-1(or 4)-monophosphatase 2; Inositol-1(or 4)-monophosphatase 2; myo-inositol monophosphatase 2; Myo-inositol monophosphatase A2
Gene Aliases: IMP.18P; IMPA2
UniProt ID: (Human) O14732
Entrez Gene ID: (Human) 3613
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.