Novus Biologicals
Manufacturer Code:NBP153028
Catalog # NBP153028
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to IMPDH2(IMP (inosine monophosphate) dehydrogenase 2) The peptide sequence was selected from the C terminal of IMPDH2 (NP_000875). Peptide sequence SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: EC 1.1.1.205 IMP (inosine 5'-monophosphate) dehydrogenase 2 IMP (inosine monophosphate) dehydrogenase 2 IMP dehydrogenase 2 IMPD 2 IMPD2IMP oxireductase 2 IMPDH 2 IMPDH-II inosine 5' phosphate dehydrogenase 2 inosine monophosphate dehydrogenase type II inosine-5'-monophosphate dehydrogenase 2; IMP (inosine 5'-monophosphate) dehydrogenase 2; IMP (inosine monophosphate) dehydrogenase 2; IMP dehydrogenase 2; IMP oxireductase 2; IMPD 2; IMPDH 2; IMPDH-II; IMPDH2; inosine 5' phosphate dehydrogenase 2; inosine monophosphate dehydrogenase type II; Inosine-5'-monophosphate dehydrogenase 2
Gene Aliases: IMPD2; IMPDH-II; IMPDH2
UniProt ID: (Human) P12268
Entrez Gene ID: (Human) 3615
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.