Novus Biologicals
Manufacturer Code:NBP238282
Catalog # NBP238282
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SMSLTVAENESGLCYNSRIRYLEKSEVTKRKEISCPDMDDFKKSDQEPDVVWYKECKPKMWRSIIIQKGNALLIQEVQEEDGGNYTCELKYEG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: IL-1 receptor accessory protein-like 2; IL-1R-9; IL-1R-9 IL1R9IL-1 receptor accessory protein-like 2 IL-1R9IL-1RAPL-2 IL-1-RAPL-2 IL1RAPL-2IL1RAPL-2-related protein interleukin 1 receptor 9 interleukin 1 receptor accessory protein-like 2 Three immunoglobulin domain-containing IL-1 receptor-related 1 TIGIRR-1Interleukin-1 receptor 9 X-linked interleukin-1 receptor accessory protein-like 2; IL1RAPL-2-related protein; interleukin 1 receptor 9; interleukin 1 receptor accessory protein-like 2; Interleukin-1 receptor 9; Three immunoglobulin domain-containing IL-1 receptor-related 1; TIGIRR-1; X-linked interleukin-1 receptor accessory protein-like 2
Gene Aliases: IL-1R9; IL1R9; IL1RAPL-2; IL1RAPL2; TIGIRR-1
UniProt ID: (Human) Q9NP60
Entrez Gene ID: (Human) 26280
Molecular Function: cytokine receptor receptor type I cytokine receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.