Novus Biologicals
Manufacturer Code:NBP169635
Catalog # NBP169635
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to IL28RA(interleukin 28 receptor alpha (interferon lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: class II cytokine receptor CRF2/12; class II cytokine receptor CRF2/12 CRF2/12 CRF2-12 Cytokine receptor class-II member 12 Cytokine receptor family 2 member 12 IFN-lambda receptor 1 IFN-lambda-R1 IFNLR IFNLR1 IL-28 receptor subunit alpha IL-28R1 IL-28RA IL-28R-alpha Interferon lambda receptor 1 interferon lambda receptor 1 interleukin 28 receptor A interleukin 28 receptor alpha interleukin 28 receptor alpha (interferon lambda receptor) interleukin or cytokine receptor 2 interleukin-28 receptor subunit alpha LICR2 Likely interleukin or cytokine receptor 2; CRF2-12; Cytokine receptor class-II member 12; Cytokine receptor family 2 member 12; IFN-lambda receptor 1; IFN-lambda-R1; IL-28 receptor subunit alpha; IL-28R-alpha; IL-28RA; Interferon lambda receptor 1; interferon lambda, receptor 1; interferon, lambda receptor 1; interleukin 28 alpha receptor; interleukin 28 receptor A; interleukin 28 receptor, alpha (interferon, lambda receptor); interleukin or cytokine receptor 2; Interleukin-28 receptor subunit alpha; LICR2; Likely interleukin or cytokine receptor 2
Gene Aliases: CRF2/12; IFNLR; IFNLR1; IL-28R1; IL28RA; LICR2
UniProt ID: (Human) Q8IU57
Entrez Gene ID: (Human) 163702
Molecular Function:
cytokine receptor
defense/immunity protein
receptor
type I cytokine receptor
type II cytokine receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.