Novus Biologicals
Manufacturer Code:NB100739
Catalog # NB100739
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
ELISA (ELISA) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD360; CD360 antigen IL-21 receptor IL-21R interleukin 21 receptor interleukin-21 receptor MGC10967 NILR Novel interleukin receptor; IL-21 receptor; Interleukin-21 receptor; Novel interleukin receptor
Gene Aliases: CD360; IL21R; NILR; UNQ3121/PRO10273
UniProt ID: (Human) Q9HBE5
Entrez Gene ID: (Human) 50615
Molecular Function:
cytokine receptor
receptor
type I cytokine receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.