Novus Biologicals
Manufacturer Code:NBP234148
Catalog # NBP234148
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD122; CD122 antigen; CD122 CD122 antigen high affinity IL-2 receptor beta subunit High affinity IL-2 receptor subunit beta IL-2 receptor subunit beta IL-2R subunit beta IL-2RB interleukin 15 receptor beta interleukin 2 receptor beta interleukin-2 receptor subunit beta P70-75 p75; high affinity IL-2 receptor beta subunit; High affinity IL-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; interleukin 15 receptor, beta; interleukin 2 receptor, beta; Interleukin-15 receptor subunit beta; Interleukin-2 receptor subunit beta; p70-75; p75
Gene Aliases: CD122; IL15RB; IL2RB; P70-75
UniProt ID: (Human) P14784
Entrez Gene ID: (Human) 3560
Molecular Function: cytokine receptor receptor type I cytokine receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.