Novus Biologicals
Manufacturer Code:NBP233599
Catalog # NBP233599
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha-pregnancy-associated endometrial globulin; alpha-pregnancy-associated endometrial globulin amniotic fluid binding protein binding protein-25 binding protein-26 binding protein-28 growth hormone independent-binding protein hIGFBP-1 IBP1 IBP-1 IGF-binding protein 1 IGFBP-1 IGF-BP25 insulin-like growth factor binding protein 1 insulin-like growth factor-binding protein 1 Placental protein 12 PP12AFBP; amniotic fluid binding protein; binding protein-25; binding protein-26; binding protein-28; growth hormone independent-binding protein; IBP-1; IGF-binding protein 1; IGFBP-1; insulin-like growth factor binding protein 1; Insulin-like growth factor-binding protein 1; Placental protein 12; PP12
Gene Aliases: AFBP; hIGFBP-1; IBP1; IGF-BP25; IGFBP1; PP12
UniProt ID: (Human) P08833
Entrez Gene ID: (Human) 3484
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.