Novus Biologicals
Manufacturer Code:NBP238956
Catalog # NBP238956
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Coding region determinant-binding protein; Coding region determinant-binding protein CRD-BP CRDBPIGF-II mRNA-binding protein 1 IGF II mRNA binding protein 1 IMP1 IMP-1ZBP-1 insulin-like growth factor 2 mRNA binding protein 1 insulin-like growth factor 2 mRNA-binding protein 1 VICKZ family member 1 VICKZ1 ZBP1IGF2 mRNA-binding protein 1 Zip code-binding protein 1 Zipcode-binding protein 1; CRD-BP; IGF-II mRNA-binding protein 1; IGF2 mRNA-binding protein 1; insulin-like growth factor 2 mRNA binding protein 1 deltaN CRDBP; Insulin-like growth factor 2 mRNA-binding protein 1; VICKZ family member 1; ZBP-1; Zipcode-binding protein 1
Gene Aliases: CRD-BP; CRDBP; IGF2BP1; IMP-1; IMP1; VICKZ1; ZBP1
UniProt ID: (Human) Q9NZI8
Entrez Gene ID: (Human) 10642
Molecular Function:
RNA binding protein
enzyme modulator
mRNA processing factor
mRNA splicing factor
nucleic acid binding
ribonucleoprotein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.