Novus Biologicals
Manufacturer Code:NBP18020720UL
Catalog # NBP18020720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human IFT140. Peptide sequence VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ30571 gs114 intraflagellar transport 140 homolog (Chlamydomonas) intraflagellar transport protein 140 homolog WDTC2; intraflagellar transport 140 homolog; Intraflagellar transport protein 140 homolog; WD and tetratricopeptide repeats protein 2
Gene Aliases: c305C8.4; c380F5.1; gs114; IFT140; KIAA0590; MZSDS; SRTD9; WDTC2
UniProt ID: (Human) Q96RY7
Entrez Gene ID: (Human) 9742
Molecular Function:
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.