Novus Biologicals
Manufacturer Code:NBP154842
Catalog # NBP154842
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to IFT122(intraflagellar transport 122 homolog (Chlamydomonas)) The peptide sequence was selected from the C terminal of IFT122. Peptide sequence QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: intraflagellar transport 122 homolog; intraflagellar transport 122 homolog (Chlamydomonas) intraflagellar transport protein 122 homolog SPGWD repeat-containing protein 140 WD repeat domain 10 WD repeat-containing protein 10 WDR10WDR10p WDR140CED; Intraflagellar transport protein 122 homolog; WD repeat domain 10; WD repeat-containing protein 10; WD repeat-containing protein 140
Gene Aliases: CED; CED1; IFT122; SPG; WDR10; WDR10p; WDR140
UniProt ID: (Human) Q9HBG6
Entrez Gene ID: (Human) 55764
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.