Novus Biologicals
Manufacturer Code:NBP15758720UL
Catalog # NBP15758720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to IDI1(isopentenyl-diphosphate delta isomerase 1) The peptide sequence was selected from the middle region of IDI1. Peptide sequence PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 5.3.3.2 IPP isomerase 1 IPP1 IPPI1 isopentenyl diphosphate dimethylallyl diphosphate isomerase 1 Isopentenyl pyrophosphate isomerase 1 isopentenyl-diphosphate delta isomerase isopentenyl-diphosphate delta isomerase 1 isopentenyl-diphosphate Delta-isomerase 1; IPP isomerase 1; isopentenyl diphosphate dimethylallyl diphosphate isomerase 1; Isopentenyl pyrophosphate isomerase 1; Isopentenyl-diphosphate Delta-isomerase 1
Gene Aliases: IDI1; IPP1; IPPI1
UniProt ID: (Human) Q13907
Entrez Gene ID: (Human) 3422
Molecular Function: isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.