Novus Biologicals
Manufacturer Code:NBP258706
Catalog # NBP258706
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.1.1 EC 1.1.1.41 FLJ11043 H-IDHB isocitrate dehydrogenase [NAD] subunit beta mitochondrial isocitrate dehydrogenase 3 (NAD+) beta isocitrate dehydrogenase NAD(+)-specific mitochondrial beta subunit Isocitric dehydrogenase subunit beta MGC903 NAD(+)-specific ICDH subunit beta NAD+-specific ICDH NAD+-specific isocitrate dehydrogenase b subunit NAD+-specific isocitrate dehydrogenase beta RP46; isocitrate dehydrogenase 3 (NAD+) beta; Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial; Isocitric dehydrogenase subunit beta; NAD(+)-specific ICDH subunit beta
Gene Aliases: IDH3B; RP46
UniProt ID: (Human) O43837
Entrez Gene ID: (Human) 3420
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.