Novus Biologicals
Manufacturer Code:NBP154736
Catalog # NBP154736
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to IDH3A(isocitrate dehydrogenase 3 (NAD+) alpha) The peptide sequence was selected from the N terminal of IDH3A. Peptide sequence MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.1.1 EC 1.1.1.41 H-IDH alpha isocitrate dehydrogenase (NAD+) alpha chain isocitrate dehydrogenase [NAD] subunit alpha mitochondrial isocitrate dehydrogenase 3 (NAD+) alpha Isocitric dehydrogenase subunit alpha NAD(+)-specific ICDH subunit alpha NAD(H)-specific isocitrate dehydrogenase alpha subunit NAD+-specific ICDH; H-IDH alpha; isocitrate dehydrogenase (NAD+) alpha chain; isocitrate dehydrogenase 3 (NAD+) alpha; Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; Isocitric dehydrogenase subunit alpha; NAD(+)-specific ICDH subunit alpha; NAD(H)-specific isocitrate dehydrogenase alpha subunit; NAD+-specific ICDH
Gene Aliases: IDH3A
UniProt ID: (Human) Q9H3X0
Entrez Gene ID: (Human) 3419
Molecular Function:
dehydrogenase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.