Novus Biologicals
Manufacturer Code:NBP15501420UL
Catalog # NBP15501420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ICT1(immature colon carcinoma transcript 1) The peptide sequence was selected from the middle region of ICT1. Peptide sequence AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 39S ribosomal protein L58, mitochondrial; Digestion substraction 1; Digestion substraction 1 DS-1DS1 EC 3.1.1.29 immature colon carcinoma transcript 1 Immature colon carcinoma transcript 1 protein peptidyl-tRNA hydrolase ICT1 mitochondrial; DS-1; Immature colon carcinoma transcript 1 protein; Mitochondrial large ribosomal subunit protein mL62; MRP-L58; Peptidyl-tRNA hydrolase ICT1, mitochondrial
Gene Aliases: DS-1; DS1; ICT1; MRP-L58; MRPL58
UniProt ID: (Human) B2RAD1
Entrez Gene ID: (Human) 3396
Molecular Function:
RNA binding protein
nucleic acid binding
translation factor
translation release factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.