Novus Biologicals
Manufacturer Code:NBP15529420UL
Catalog # NBP15529420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HAO1(hydroxyacid oxidase (glycolate oxidase) 1) The peptide sequence was selected from the C terminal of HAO1. Peptide sequence GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (S)-2-hydroxy-acid oxidase; (S)-2-hydroxy-acid oxidase EC 1.1.3.15 Glycolate oxidase GOX1MGC142227 GOXMGC142225 HAOX1 hydroxyacid oxidase (glycolate oxidase) 1 hydroxyacid oxidase 1; Glycolate oxidase; glycolate oxidase 1; GOX; HAOX1; hydroxyacid oxidase (glycolate oxidase) 1; Hydroxyacid oxidase 1
Gene Aliases: GOX; GOX1; HAO1; HAOX1
UniProt ID: (Human) Q9UJM8
Entrez Gene ID: (Human) 54363
Molecular Function:
dehydrogenase
isomerase
ligase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.