Novus Biologicals
Manufacturer Code:NBP238674
Catalog # NBP238674
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP6B ATPase H+/K+ exchanging beta polypeptide ATPase H+/K+ transporting beta polypeptide Gastric H(+)/K(+) ATPase subunit beta gastric H+/K+ ATPase beta subunit gastric hydrogen-potassium ATPase beta potassium-transporting ATPase beta chain potassium-transporting ATPase subunit beta Proton pump beta chain; ATPase, H+/K+ exchanging, beta polypeptide; ATPase, H+/K+ transporting, beta polypeptide; Gastric H(+)/K(+) ATPase subunit beta; gastric H+/K+ ATPase beta subunit; gastric hydrogen-potassium ATPase, beta; potassium-transporting ATPase beta chain; Potassium-transporting ATPase subunit beta; Proton pump beta chain
Gene Aliases: ATP4B; ATP6B
UniProt ID: (Human) P51164
Entrez Gene ID: (Human) 496
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.