Novus Biologicals
Manufacturer Code:NBP188293
Catalog # NBP188293
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C20orf60 chromosome 20 open reading frame 60 dJ1009E24.2 FLJ32150 heat shock 70 kDa protein 12B heat shock 70kD protein 12B MGC131912; Heat shock 70 kDa protein 12B
Gene Aliases: C20orf60; HSPA12B
UniProt ID: (Human) Q96MM6
Entrez Gene ID: (Human) 116835
Molecular Function: Hsp70 family chaperone chaperone kinase non-receptor serine/threonine protein kinase protein kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.