Novus Biologicals
Manufacturer Code:NBP247427
Catalog # NBP247427
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AAG2 aging-associated protein 2 FAM10A1FAM10A4 heat shock 70kD protein binding protein Hip HIPFLJ27260 HOP hsc70-interacting protein Hsp70-interacting protein HSPABP1 P48MGC129952 PRO0786 Progesterone receptor-associated p48 protein Protein FAM10A1 Putative tumor suppressor ST13 Renal carcinoma antigen NY-REN-33 SNC6HSPABP suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein) Suppression of tumorigenicity 13 protein; Aging-associated protein 2; heat shock 70kD protein binding protein; Hip; Hsc70-interacting protein; Hsp70-interacting protein; Progesterone receptor-associated p48 protein; Protein FAM10A1; Putative tumor suppressor ST13; Renal carcinoma antigen NY-REN-33; Suppression of tumorigenicity 13 protein; testis secretory sperm-binding protein Li 233m
Gene Aliases: AAG2; FAM10A1; FAM10A4; HIP; HOP; HSPABP; HSPABP1; P48; PRO0786; SNC6; ST13
UniProt ID: (Human) P50502
Entrez Gene ID: (Human) 6767
Molecular Function:
chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.