Novus Biologicals
Manufacturer Code:NBP188172
Catalog # NBP188172
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (collagen binding protein 1) Arsenic-transactivated protein 3 AsTP3 CBP1 CBP2RA-A47 Cell proliferation-inducing gene 14 protein Collagen-binding protein colligen Colligin colligin-1 colligin-2 gp46 HSP47serine (or cysteine) proteinase inhibitor clade H (heat shock protein 47) member 1 (collagen binding protein 1) member 2 member 2 (collagen-binding protein 2) PPROM proliferation-inducing gene 14 rheumatoid arthritis antigen A-4747 kDa heat shock protein Rheumatoid arthritis-related antigen RA-A47 serine (or cysteine) proteinase inhibitor clade H (heat shock protein 47) serpin H1 serpin peptidase inhibitor clade H (heat shock protein 47) member 1 SERPINH2colligin; 47 kDa heat shock protein; Arsenic-transactivated protein 3; AsTP3; Cell proliferation-inducing gene 14 protein; collagen binding protein 1; Collagen-binding protein; Colligin; colligin-1; colligin-2; rheumatoid arthritis antigen A-47; Rheumatoid arthritis-related antigen RA-A47; serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1); serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 2, (collagen-binding protein 2); Serpin H1; serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
Gene Aliases: AsTP3; CBP1; CBP2; gp46; HSP47; OI10; PIG14; PPROM; RA-A47; SERPINH1; SERPINH2
UniProt ID: (Human) B3KVJ3
Entrez Gene ID: (Human) 871
Molecular Function:
enzyme modulator
protease inhibitor
serine protease inhibitor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.