Novus Biologicals
Manufacturer Code:NBP153002
Catalog # NBP153002
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to H2AFY(H2A histone family member Y) The peptide sequence was selected from the middle region of H2AFY. Peptide sequence PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Core histone macro-H2A.1; core histone macro-H2A.1 H2A histone family member Y H2A.y H2A/y H2AF12M H2AFJ Histone H2A.y Histone macroH2A1 histone macroH2A1.1 histone macroH2A1.2 MACROH2A1 MACROH2A1.1 macroH2A1.2 Medulloblastoma antigen MU-MB-50.205 mH2A1; H2A histone family, member Y; H2A/y; Histone H2A.y; Histone macroH2A1; histone macroH2A1.1; histone macroH2A1.2; Medulloblastoma antigen MU-MB-50.205
Gene Aliases: H2A.y; H2A/y; H2AF12M; H2AFY; MACROH2A1; MACROH2A1.1; macroH2A1.2; mH2A1
UniProt ID: (Human) O75367
Entrez Gene ID: (Human) 9555
Molecular Function:
DNA binding protein
histone
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.