Novus Biologicals
Manufacturer Code:NBP158058
Catalog # NBP158058
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HS3ST1(heparan sulfate (glucosamine) 3-O-sulfotransferase 1) The peptide sequence was selected from the middle region of HS3ST1. Peptide sequence TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-OST-1; 3OST 3-OST-1 3OST1Heparan sulfate 3-O-sulfotransferase 1 EC 2.8.2 EC 2.8.2.23 h3-OST-1 heparan sulfate (glucosamine) 3-O-sulfotransferase 1 Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1 heparan sulfate glucosamine 3-O-sulfotransferase 1 heparin-glucosamine 3-O-sulfotransferase; h3-OST-1; heparan sulfate (glucosamine) 3-O-sulfotransferase 1; heparan sulfate 3-O-sulfotransferase 1; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1; Heparan sulfate glucosamine 3-O-sulfotransferase 1; heparin-glucosamine 3-O-sulfotransferase
Gene Aliases: 3OST; 3OST1; HS3ST1
UniProt ID: (Human) O14792
Entrez Gene ID: (Human) 9957
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.