Novus Biologicals
Manufacturer Code:NBP158290
Catalog # NBP158290
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FICD(FIC domain containing) The peptide sequence was selected from the C terminal of FICD. Peptide sequence GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AMPylator FICD; AMPylator FICD EC 2.7.7.n1 FIC domain containing FIC domain-containing protein fic S-phase protein cell division homolog HIP-13 HIP13UNQ3041 huntingtin interacting protein 13 Huntingtin interacting protein E huntingtin interactor protein E Huntingtin yeast partner E Huntingtin-interacting protein 13 Huntingtin-interacting protein E HYPEadenosine monophosphate-protein transferase FICD MGC5623; De-AMPylase FICD; FIC domain-containing protein; fic S-phase protein cell division homolog; HIP-13; huntingtin interacting protein 13; Huntingtin interacting protein E; huntingtin interactor protein E; Huntingtin yeast partner E; Huntingtin-interacting protein 13; Huntingtin-interacting protein E; Protein adenylyltransferase FICD
Gene Aliases: FICD; HIP13; HYPE; UNQ3041; UNQ3041/PRO9857
UniProt ID: (Human) Q9BVA6
Entrez Gene ID: (Human) 11153
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.