Novus Biologicals
Manufacturer Code:NBP17991120UL
Catalog # NBP179920UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is HYAL3. Peptide sequence RAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.2.1.35 Hyal-3 hyaluronidase-3 hyaluronoglucosaminidase 3 Hyaluronoglucosaminidase-3 LUCA14 LuCa-3 LUCA3LUCA-3 Lung carcinoma protein 3 Minna14; Hyal-3; Hyaluronidase-3; Hyaluronoglucosaminidase-3; LuCa-3; Lung carcinoma protein 3
Gene Aliases: HYAL-3; HYAL3; LUCA-3; LUCA3
UniProt ID: (Human) O43820
Entrez Gene ID: (Human) 8372
Molecular Function:
glycosidase
hydrolase
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.