Novus Biologicals
Manufacturer Code:NBP189662
Catalog # NBP189662
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Antigen NY-CO-25; Antigen NY-CO-25 heat shock 105kD beta heat shock 105kDa protein 1 heat shock 105kDa/110kDa protein 1 Heat shock 110 kDa protein heat shock protein 105 kDa HSP105A HSP105B HSP105heat shock 105kD alpha HSP110 KIAA0201DKFZp686M05240 NY-CO-25; heat shock 105kD alpha; heat shock 105kD beta; heat shock 105kDa/110kDa protein 1; Heat shock 110 kDa protein; Heat shock protein 105 kDa
Gene Aliases: HSP105; HSP105A; HSP105B; HSP110; HSPH1; KIAA0201; NY-CO-25
UniProt ID: (Human) Q92598
Entrez Gene ID: (Human) 10808
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.