Novus Biologicals
Manufacturer Code:NBP230707
Catalog # NBP230707
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 15E1.1 MDM35 MDM-35 Mitochondrial Distribution And Morphology 35 Homolog P53CSV P53-Inducible Cell-Survival Factor Protein 15E1.1 TP53 regulated inhibitor of apoptosis 1 TP53-Regulated Inhibitor Of Apoptosis TRIAP1 WF-1; mitochondrial distribution and morphology 35 homolog; p53-inducible cell-survival factor; p53CSV; Protein 15E1.1; TP53-regulated inhibitor of apoptosis 1; WF-1
Gene Aliases: 15E1.1; HSPC132; MDM35; P53CSV; TRIAP1; WF-1
UniProt ID: (Human) O43715
Entrez Gene ID: (Human) 51499
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.