Novus Biologicals
Manufacturer Code:NBP158213
Catalog # NBP158213
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to HSPA2(heat shock 70kDa protein 2) The peptide sequence was selected from the middle region of HSPA2. Peptide sequence ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Heat shock 70 kDa protein 2; Heat shock 70 kDa protein 2 heat shock 70kD protein 2 heat shock 70kDa protein 2 heat shock-related 70 kDa protein 2 HSP70-2 HSP70-3; heat shock 70kD protein 2; heat shock 70kDa protein 2; Heat shock-related 70 kDa protein 2
Gene Aliases: HSP70-2; HSP70-3; HSPA2
UniProt ID: (Human) P54652
Entrez Gene ID: (Human) 3306
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.