Novus Biologicals
Manufacturer Code:NBP214102
Catalog # NBP214102
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMD LDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 17 beta-hydroxysteroid dehydrogenase type VII; 17 beta-hydroxysteroid dehydrogenase type VII 17-beta-hydroxysteroid dehydrogenase 7 3-keto-steroid reductase EC 1.1.1.270 EC 1.1.1.62 Estradiol 17-beta-dehydrogenase 7 hydroxysteroid (17-beta) dehydrogenase 717beta hydroxysteroid dehydrogenase MGC12523 MGC7501817-beta-HSD 7 PRAP SDR37C1 short chain dehydrogenase/reductase family 37C member 1; 17-beta-HSD 7; 17-beta-hydroxysteroid dehydrogenase 7; 17beta hydroxysteroid dehydrogenase; 3-keto-steroid reductase; 3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7; Dihydrotestosterone oxidoreductase; Estradiol 17-beta-dehydrogenase 7; hydroxysteroid (17-beta) dehydrogenase 7; Short chain dehydrogenase/reductase family 37C member 1; short chain dehydrogenase/reductase family 37C, member 1
Gene Aliases: 17HSD7; HSD17B7; PRAP; SDR37C1; UNQ2563/PRO6243
UniProt ID: (Human) P56937
Entrez Gene ID: (Human) 51478
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.