Novus Biologicals
Manufacturer Code:NBP185296
Catalog # NBP185296
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: (3R)-hydroxyacyl-CoA dehydrogenase; 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase 7-alpha D-bifunctional protein EDH17B4 hydroxysteroid (17-beta) dehydrogenase 4 MPF-2 peroxisomal peroxisomal multifunctional enzyme type 217-beta-HSD IV peroxisomal multifunctional protein 217beta-estradiol dehydrogenase type IV short chain dehydrogenase/reductase family 8C member 13-alpha; 17-beta-HSD 4; 17-beta-HSD IV; 17-beta-hydroxysteroid dehydrogenase 4; 17beta-estradiol dehydrogenase type IV; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase; beta-hydroxyacyl dehydrogenase; beta-keto-reductase; D-3-hydroxyacyl-CoA dehydratase; D-bifunctional protein; D-bifunctional protein, peroxisomal; DBP; Enoyl-CoA hydratase 2; hydroxysteroid (17-beta) dehydrogenase 4; hydroxysteroid dehydrogenase 4; MFE-2; MFP-2; Multifunctional protein 2; Peroxisomal multifunctional enzyme type 2; peroxisomal multifunctional protein 2; Short chain dehydrogenase/reductase family 8C member 1; short chain dehydrogenase/reductase family 8C, member 1
Gene Aliases: DBP; EDH17B4; HSD17B4; MFE-2; MPF-2; PRLTS1; SDR8C1
UniProt ID: (Human) B4DVS5
Entrez Gene ID: (Human) 3295
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.