Novus Biologicals
Manufacturer Code:NBP238807
Catalog # NBP238807
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NVGILPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLIL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 17-beta-HSD 3; 17-beta-HSD3; 17-beta-hydroxysteroid dehydrogenase type 3; EC 1.1.1.64 EDH17B317-beta-HSD3 hydroxysteroid (17-beta) dehydrogenase 317-beta-hydroxysteroid dehydrogenase type 3 SDR12C2 short chain dehydrogenase/reductase family 12C member 2 Testicular 17-beta-hydroxysteroid dehydrogenase testosterone 17-beta-dehydrogenase 317-beta-HSD 3; Estradiol 17-beta-dehydrogenase 2; hydroxysteroid (17-beta) dehydrogenase 3; hydroxysteroid dehydrogenase 3; Short chain dehydrogenase/reductase family 12C member 2; short chain dehydrogenase/reductase family 12C, member 2; Testicular 17-beta-hydroxysteroid dehydrogenase; Testosterone 17-beta-dehydrogenase 3
Gene Aliases: EDH17B3; HSD17B3; SDR12C2
UniProt ID: (Human) P37058
Entrez Gene ID: (Human) 3293
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.