Novus Biologicals
Manufacturer Code:NBP192011
Catalog # NBP192011
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 17-beta-HSD 2; 17-beta-hydroxysteroid dehydrogenase type 2; 17-beta-hydroxysteroid dehydrogenase type 2 20 alpha-hydroxysteroid dehydrogenase E2DH EC 1.1.1.6217-beta-HSD 2 EC 1.1.1.63 EDH17B220-alpha-HSD estradiol 17-beta-dehydrogenase 2 HSD17 hydroxysteroid (17-beta) dehydrogenase 2 Microsomal 17-beta-hydroxysteroid dehydrogenase SDR9C2 short chain dehydrogenase/reductase family 9C member 2 Testosterone 17-beta-dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; E2DH; Estradiol 17-beta-dehydrogenase 2; hydroxysteroid (17-beta) dehydrogenase 2; Microsomal 17-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 2; short chain dehydrogenase/reductase family 9C, member 2; Testosterone 17-beta-dehydrogenase
Gene Aliases: EDH17B2; HSD17; HSD17B2; SDR9C2
UniProt ID: (Human) P37059
Entrez Gene ID: (Human) 3294
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.