Novus Biologicals
Manufacturer Code:NBP237898
Catalog # NBP237898
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: -HSD11 type II; 11-beta-HSD; 11-beta-HSD type II; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-hydroxysteroid dehydrogenase type II; 11-DH2; 11-HSD type II; AME corticosteroid 11-beta-dehydrogenase isozyme 211-beta-HSD2 EC 1.1.1 EC 1.1.1.- HSD11KAME1 HSD211-DH2 hydroxysteroid (11-beta) dehydrogenase 2 NAD-dependent 11-beta-hydroxysteroid dehydrogenase SDR9C3 short chain dehydrogenase/reductase family 9C member 311-beta-hydroxysteroid dehydrogenase type 2; Corticosteroid 11-beta-dehydrogenase isozyme 2; hydroxysteroid (11-beta) dehydrogenase 2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 3
Gene Aliases: AME; AME1; HSD11B2; HSD11K; HSD2; SDR9C3
UniProt ID: (Human) P80365
Entrez Gene ID: (Human) 3291
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.