Novus Biologicals
Manufacturer Code:NBP255930
Catalog # NBP255930
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-OST-5; 3-OST-5EC 2.8.2.23 3OST5NBLA04021 EC 2.8.2 h3-OST-5 heparan sulfate (glucosamine) 3-O-sulfotransferase 5 heparan sulfate 3-OST-5 Heparan sulfate 3-O-sulfotransferase 5 Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 5 heparan sulfate glucosamine 3-O-sulfotransferase 5 HS3OST5; h3-OST-5; heparan sulfate (glucosamine) 3-O-sulfotransferase 5; heparan sulfate 3-O-sulfotransferase 5; heparan sulfate 3-OST-5; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 5; Heparan sulfate glucosamine 3-O-sulfotransferase 5
Gene Aliases: 3-OST-5; 3OST5; HS3OST5; HS3ST5; NBLA04021
UniProt ID: (Human) Q8IZT8
Entrez Gene ID: (Human) 222537
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.