Novus Biologicals
Manufacturer Code:NBP182453
Catalog # NBP182453
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 14.5 kDa translational inhibitor protein; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.1 heat-responsive protein 12perchloric acid-soluble protein P14.5 PSPribonuclease UK114 translational inhibitor protein p14.514.5 kDa translational inhibitor protein UK114 antigen homolog UK114translational inhibitor p14.5; Heat-responsive protein 12; hp14.5; perchloric acid-soluble protein; Reactive intermediate imine deaminase A homolog; reactive intermediate/imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; translational inhibitor p14.5; translational inhibitor protein p14.5; UK114 antigen homolog
Gene Aliases: HRSP12; P14.5; PSP; RIDA; UK114
UniProt ID: (Human) P52758
Entrez Gene ID: (Human) 10247
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.