Novus Biologicals
Manufacturer Code:NBP254946
Catalog # NBP254946
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: E2 ubiquitin-conjugating enzyme A; EC 6.3.2.19 hHR6A HR6A RAD6ARAD6 homolog A UBC2 Ubiquitin carrier protein A ubiquitin-conjugating enzyme E2 A ubiquitin-conjugating enzyme E2A (RAD6 homolog) Ubiquitin-protein ligase A; HR6A; RAD6 homolog A; Ubiquitin carrier protein A; ubiquitin conjugating enzyme E2A; Ubiquitin-conjugating enzyme E2 A; Ubiquitin-protein ligase A
Gene Aliases: HHR6A; MRXS30; MRXSN; RAD6A; UBC2; UBE2A
UniProt ID: (Human) P49459
Entrez Gene ID: (Human) 7319
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.