Novus Biologicals
Manufacturer Code:NBP179857
Catalog # NBP179857
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human HPDLThe immunogen for this antibody is HPDL. Peptide sequence GPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4-hydroxyphenylpyruvate dioxygenase-like 4-hydroxyphenylpyruvate dioxygenase-like protein EC 1.13 GLOXD14-HPPD-L glyoxalase domain containing 1 Glyoxalase domain-containing protein 1 MGC15668 RP4-534D1.1; 4-hydroxyphenylpyruvate dioxygenase-like protein; glyoxalase domain containing 1; Glyoxalase domain-containing protein 1; HPD-like protein
Gene Aliases: 4-HPPD-L; GLOXD1; HPDL
UniProt ID: (Human) Q96IR7
Entrez Gene ID: (Human) 84842
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.