Novus Biologicals
Manufacturer Code:NBP237877
Catalog # NBP237877
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAETSAVCTAASVIRNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1600020H07Rik; 1600020H07Rik 22-HPCL 2-hydroxyacyl-CoA lyase 1 2-hydroxyphytanoyl-CoA lyase2-hydroxyphytanol-CoA lyase EC 4.1 HPCL PHYH2FLJ55041 Phytanoyl-CoA 2-hydroxylase 2 phytanoyl-CoA hydroxylase 2; 2-HPCL; 2-hydroxyacyl-CoA lyase 1; 2-hydroxyphytanol-CoA lyase; 2-hydroxyphytanoyl-CoA lyase; Phytanoyl-CoA 2-hydroxylase 2; phytanoyl-CoA hydroxylase 2
Gene Aliases: 2-HPCL; HACL1; HPCL; HPCL2; HSPC279; PHYH2
UniProt ID: (Human) Q9UJ83
Entrez Gene ID: (Human) 26061
Molecular Function:
decarboxylase
dehydrogenase
lyase
oxidoreductase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.